PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g08730
Common NameGSCOC_T00023907001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family NAC
Protein Properties Length: 401aa    MW: 44827.2 Da    PI: 5.7353
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g08730genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.82.5e-50291551128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                  + pGfrF+Ptdeel+++yLkkkveg ++++ +vi+evdi+++ePwdLp k+v  ++kew+fFs+r +ky++g++++rat+ gyWkatgk+++++s ++
  Cc01_g08730  29 MFPGFRFSPTDEELICFYLKKKVEGLDNSV-DVIPEVDICRFEPWDLPgKSVIPSDKEWFFFSPRGRKYPNGSQSKRATDLGYWKATGKERNIKS-GS 124
                  579************************999.99***************76666799***************************************.99 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + +g+k+tLvf++grapkg++t+W+mhey +
  Cc01_g08730 125 TIIGTKRTLVFHTGRAPKGQRTEWIMHEYCM 155
                  9****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-5721170IPR003441NAC domain
PROSITE profilePS5100554.02129171IPR003441NAC domain
PfamPF023658.9E-2631154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MGDQQENEIT GSSSTKKNME ISMAEASSMF PGFRFSPTDE ELICFYLKKK VEGLDNSVDV  60
IPEVDICRFE PWDLPGKSVI PSDKEWFFFS PRGRKYPNGS QSKRATDLGY WKATGKERNI  120
KSGSTIIGTK RTLVFHTGRA PKGQRTEWIM HEYCMSGKSQ DFMVVCRLRK NTEFHLDDSP  180
RRKPQEGRHP SAANNNAAAS SGIEQTDASE GALLGDCWSK ECSSSNNSHS TDQIESGFEC  240
DDKVPNELSP YASSSHQKDC DSIEEDYFAD IMKDDIIQLD DSAIYASPQQ LQAVAPDPES  300
QNKSKQPAED TPSCSLPFQG TANRRLRLGR QKLEYNEAHP LNRYRVDKAN LPPKLVSQAD  360
LQQPPKLLVR LFSNVGSERL SIFFIALIIL AALFLYVQVG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-442817016164NO APICAL MERISTEM PROTEIN
1ut4_B2e-442817016164NO APICAL MERISTEM PROTEIN
1ut7_A2e-442817016164NO APICAL MERISTEM PROTEIN
1ut7_B2e-442817016164NO APICAL MERISTEM PROTEIN
3swm_A2e-442817019167NAC domain-containing protein 19
3swm_B2e-442817019167NAC domain-containing protein 19
3swm_C2e-442817019167NAC domain-containing protein 19
3swm_D2e-442817019167NAC domain-containing protein 19
3swp_A2e-442817019167NAC domain-containing protein 19
3swp_B2e-442817019167NAC domain-containing protein 19
3swp_C2e-442817019167NAC domain-containing protein 19
3swp_D2e-442817019167NAC domain-containing protein 19
4dul_A2e-442817016164NAC domain-containing protein 19
4dul_B2e-442817016164NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006361089.11e-135PREDICTED: NAC domain-containing protein 89-like isoform X1
SwissprotQ9LXL94e-86NAC60_ARATH; NAC domain-containing protein 60
TrEMBLA0A068UGV50.0A0A068UGV5_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000150771e-134(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.13e-85NAC domain containing protein 60